PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1412s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 482aa    MW: 53670.5 Da    PI: 8.2826
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1412s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox34.33.9e-112963331954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yp+ +e++ LA+++gL+ +qV++WF N R +
  SapurV1A.1412s0040.1.p 296 FEHflHPYPTDSEKQALAQQTGLSRTQVSNWFINARVR 333
                             664459******************************88 PP

2BELL92.54.1e-30163233272
                    BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              +e+q k +kL+ +l+eV++rYk y++q+q v++sFe+vaglg+a+pY+  A k++S+hF +Lk+a+ ++i
  SapurV1A.1412s0040.1.p 163 GMEHQWKSSKLILMLDEVYRRYKLYCQQMQSVVASFETVAGLGNAAPYVCCAIKTVSKHFTSLKNALLDKI 233
                             589****************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.3E-36109231IPR006563POX domain
PfamPF075263.7E-34114229IPR006563POX domain
PROSITE profilePS5007112.584274337IPR001356Homeobox domain
SMARTSM003891.7E-12277341IPR001356Homeobox domain
CDDcd000862.61E-13277338No hitNo description
SuperFamilySSF466893.55E-18280345IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28280341IPR009057Homeodomain-like
PfamPF059201.1E-18294333IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MAQNIEPFHV PQQNRKNKLR VTTQSNQEQQ NPPTPLFSRQ APMNPSQSSS FSSLQSLKDM  60
NYQPLTSQGL SLCLSFQLDN NQRYNAASVS GDYINGEMRS SVGPFGPFTG YASILMSSRF  120
LKPAQQILDE ICGVINCANA NFPLDGLSES ETMKESTAFP SDGMEHQWKS SKLILMLDEV  180
YRRYKLYCQQ MQSVVASFET VAGLGNAAPY VCCAIKTVSK HFTSLKNALL DKIQLTGRTF  240
AESSVAKEKS PRYGTAERGP GNQNPSRNLN FIQHSVWRSQ RGLPDHAVAV LRTWLFEHFL  300
HPYPTDSEKQ ALAQQTGLSR TQVSNWFINA RVRLWKPMVE EVHMLESQQT QAPSETVNQS  360
ASMPSDLPLE KQPRSTPHQN TNQMTRTRPR SQNEPPDVSK LQRQDPVNIY GNNLSGNCHS  420
AGVSGGEGVS LALGLPQNKG IDLSWPLPMS MPHRDNMEMI GMMDSAPATG FELEKQHFGK  480
E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-16278334865Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002315195.20.0hypothetical protein POPTR_0010s20480g
SwissprotQ9LZM83e-74BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLB9HT490.0B9HT49_POPTR; Uncharacterized protein
STRINGPOPTR_0008s06130.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28103373
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.13e-75TALE family protein